SCOPe 2.08: Domain d1zrpa_: 1zrp A:

Lineage for d1zrpa_ (1zrp A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (4 families)

5. Family g.41.5.1: Rubredoxin [57803] (5 proteins)

6. Protein Rubredoxin [57804] (8 species)

7. Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries)
   Uniprot P24297

8. Domain d1zrpa_: 1zrp A: [45242]
   zn-substituted
   complexed with zn

Details for d1zrpa_

PDB Entry: 1zrp

PDB Description: solution-state structure by nmr of zinc-substituted rubredoxin from the marine hyperthermophilic archaebacterium pyrococcus furiosus

PDB Compounds: (A:) rubredoxin

SCOPe Domain Sequences for d1zrpa_:

Sequence; same for both SEQRES and ATOM records:

>d1zrpa_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
akwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled

Timeline for d1zrpa_:

• d1zrpa_ first appeared (with stable ids) in SCOP 1.55, called d1zrp__
  
• d1zrpa_ appears in SCOPe 2.07