Lineage for d1yua_1 (1yua 1-65)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41508Fold g.41: Rubredoxin-like [57769] (8 superfamilies)
  4. 41551Superfamily g.41.3: Zinc beta-ribbon [57783] (3 families) (S)
  5. 41569Family g.41.3.3: Prokariotic DNA topoisomerase I, a C-terminal fragment [57795] (1 protein)
  6. 41570Protein Prokariotic DNA topoisomerase I, a C-terminal fragment [57796] (1 species)
  7. 41571Species Escherichia coli [TaxId:562] [57797] (1 PDB entry)
  8. 41572Domain d1yua_1: 1yua 1-65 [45210]

Details for d1yua_1

PDB Entry: 1yua (more details)

PDB Description: c-terminal domain of escherichia coli topoisomerase i

SCOP Domain Sequences for d1yua_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yua_1 g.41.3.3 (1-65) Prokariotic DNA topoisomerase I, a C-terminal fragment {Escherichia coli}
mngevappkedpvplpelpceksdayfvlrdgaagvflaantfpksretraplveelyrf
rdrlp

SCOP Domain Coordinates for d1yua_1:

Click to download the PDB-style file with coordinates for d1yua_1.
(The format of our PDB-style files is described here.)

Timeline for d1yua_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yua_2