Lineage for d1dvrb2 (1dvr B:131-168)

  1. Root: SCOP 1.59
  2. 142453Class g: Small proteins [56992] (58 folds)
  3. 144883Fold g.41: Rubredoxin-like [57769] (9 superfamilies)
  4. 144892Superfamily g.41.2: Microbial and mitochondrial ADK, insert "zinc finger" domain [57774] (1 family) (S)
  5. 144893Family g.41.2.1: Microbial and mitochondrial ADK, insert "zinc finger" domain [57775] (1 protein)
  6. 144894Protein Microbial and mitochondrial ADK, insert "zinc finger" domain [57776] (6 species)
  7. 144899Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57781] (4 PDB entries)
  8. 144904Domain d1dvrb2: 1dvr B:131-168 [45201]
    Other proteins in same PDB: d1dvra1, d1dvrb1

Details for d1dvrb2

PDB Entry: 1dvr (more details), 2.36 Å

PDB Description: structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp

SCOP Domain Sequences for d1dvrb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvrb2 g.41.2.1 (B:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae)}
grlihpasgrsyhkifnppkedmkddvtgealvqisdd

SCOP Domain Coordinates for d1dvrb2:

Click to download the PDB-style file with coordinates for d1dvrb2.
(The format of our PDB-style files is described here.)

Timeline for d1dvrb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dvrb1