PDB entry 1dvr

View 1dvr on RCSB PDB site
Description: structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp
Deposited on 1995-12-14, released 1996-04-03
The last revision prior to the SCOP 1.59 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.36 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvrA (A:)
    ssesirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqg
    glvsddimvnmikdeltnnpackngfilvgfprtipqaekldqmlkeqgtplekaielkv
    ddellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqisddnadalkkrlaay
    haqtepivdfykktgiwagvdasqppatvwadilnklgkn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dvrB (B:)
    ssesirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqg
    glvsddimvnmikdeltnnpackngfilvgfprtipqaekldqmlkeqgtplekaielkv
    ddellvaritgrlihpasgrsyhkifnppkedmkddvtgealvqisddnadalkkrlaay
    haqtepivdfykktgiwagvdasqppatvwadilnklgkn