Lineage for d1dvra1 (1dvr A:1-130,A:169-220)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 121669Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (12 proteins)
  6. 121670Protein Adenylate kinase [52554] (8 species)
  7. 121682Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52559] (4 PDB entries)
  8. 121686Domain d1dvra1: 1dvr A:1-130,A:169-220 [31899]
    Other proteins in same PDB: d1dvra2, d1dvrb2

Details for d1dvra1

PDB Entry: 1dvr (more details), 2.36 Å

PDB Description: structure of a mutant adenylate kinase ligated with an atp-analogue showing domain closure over atp

SCOP Domain Sequences for d1dvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dvra1 c.37.1.1 (A:1-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae)}
ssesirmvligppgagkgtqapnlqerfhaahlatgdmlrsqiakgtqlgleakkimdqg
glvsddimvnmikdeltnnpackngfilvgfprtipqaekldqmlkeqgtplekaielkv
ddellvaritXnadalkkrlaayhaqtepivdfykktgiwagvdasqppatvwadilnkl
gkn

SCOP Domain Coordinates for d1dvra1:

Click to download the PDB-style file with coordinates for d1dvra1.
(The format of our PDB-style files is described here.)

Timeline for d1dvra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dvra2