Lineage for d1iml_2 (1iml 29-76)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204719Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
  4. 204720Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) (S)
  5. 204788Family g.39.1.3: LIM domain [57736] (2 proteins)
  6. 204789Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (3 species)
  7. 204806Species Rat (Rattus rattus) [TaxId:10117] [57740] (1 PDB entry)
  8. 204808Domain d1iml_2: 1iml 29-76 [45146]

Details for d1iml_2

PDB Entry: 1iml (more details)

PDB Description: cysteine rich intestinal protein, nmr, 48 structures

SCOP Domain Sequences for d1iml_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iml_2 g.39.1.3 (29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus)}
kcekcgktltsgghaehegkpycnhpcysamfgpkgfgrggaeshtfk

SCOP Domain Coordinates for d1iml_2:

Click to download the PDB-style file with coordinates for d1iml_2.
(The format of our PDB-style files is described here.)

Timeline for d1iml_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iml_1