Lineage for d1iml_2 (1iml 29-76)
- Root: SCOP 1.59
Class g: Small proteins [56992] (58 folds) 
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (7 families) 
Family g.39.1.3: LIM domain [57736] (2 proteins) Protein Cysteine-rich (intestinal) protein, CRP, CRIP [57737] (3 species) 
Species Rat (Rattus rattus) [TaxId:10117] [57740] (1 PDB entry) 
Domain d1iml_2: 1iml 29-76 [45146]
Details for d1iml_2
PDB Entry: 1iml (more details)
PDB Description: cysteine rich intestinal protein, nmr, 48 structures
SCOP Domain Sequences for d1iml_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iml_2 g.39.1.3 (29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus)}
kcekcgktltsgghaehegkpycnhpcysamfgpkgfgrggaeshtfk
SCOP Domain Coordinates for d1iml_2:
Click to download the PDB-style file with coordinates for d1iml_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1iml_2:
- d1iml_2 first appeared (with stable ids) in SCOP 1.55
- d1iml_2 appears in SCOP 1.57
- d1iml_2 appears in SCOP 1.61
- d1iml_2 appears in the current release, SCOPe 2.08, called d1imla2
View in 3D
