PDB entry 1iml

View 1iml on RCSB PDB site
Description: cysteine rich intestinal protein, nmr, 48 structures
Deposited on 1995-12-23, released 1996-07-11
The last revision prior to the SCOP 1.61 freeze date was dated 1996-07-11, with a file datestamp of 1996-07-11.
Experiment type: NMR48
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.61: d1iml_1, d1iml_2

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1iml_ (-)
  pkcpkcdkevyfaervtslgkdwhrpclkcekcgktltsgghaehegkpycnhpcysamf
  gpkgfgrggaeshtfk