SCOP 1.67: Domain d1hcp__: 1hcp -

Lineage for d1hcp__ (1hcp -)

1. Root: SCOP 1.67

2. Class g: Small proteins [56992] (72 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (11 families)

5. Family g.39.1.2: Nuclear receptor [57721] (11 proteins)
   duplication: two zinc-binding motifs

6. Protein Estrogen receptor DNA-binding domain [57728] (1 species)

7. Species Human and chicken (Homo sapiens) and (Gallus gallus) [TaxId:9606] [57729] (2 PDB entries)
   identical sequences

8. Domain d1hcp__: 1hcp - [45121]
   complexed with zn

Details for d1hcp__

PDB Entry: 1hcp

PDB Description: dna recognition by the oestrogen receptor: from solution to the crystal

SCOP Domain Sequences for d1hcp__:

Sequence; same for both SEQRES and ATOM records:

>d1hcp__ g.39.1.2 (-) Estrogen receptor DNA-binding domain {Human and chicken (Homo sapiens) and (Gallus gallus)}
mketrycavcndyasgyhygvwscegckaffkrsiqghndymcpatnqctidknrrkscq
acrlrkcyevgmmkg

Timeline for d1hcp__:

• d1hcp__ first appeared (with stable ids) in SCOP 1.55
  
• d1hcp__ appears in SCOP 1.65
  
• d1hcp__ appears in SCOP 1.69
  
• d1hcp__ appears in the current release, SCOPe 2.08, called d1hcpa_