Lineage for d1qp9a1 (1qp9 A:55-97)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41340Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
  4. 41341Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
  5. 41342Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 41355Protein Hap1 (Cyp1) [57709] (1 species)
  7. 41356Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57710] (4 PDB entries)
  8. 41363Domain d1qp9a1: 1qp9 A:55-97 [45091]
    Other proteins in same PDB: d1qp9a2, d1qp9b2, d1qp9c2, d1qp9d2

Details for d1qp9a1

PDB Entry: 1qp9 (more details), 2.8 Å

PDB Description: structure of hap1-pc7 complexed to the uas of cyc7

SCOP Domain Sequences for d1qp9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp9a1 g.38.1.1 (A:55-97) Hap1 (Cyp1) {Baker's yeast (Saccharomyces cerevisiae)}
rkrnriplgcticrkrkvkcdklrphcqqctktgvahlchyme

SCOP Domain Coordinates for d1qp9a1:

Click to download the PDB-style file with coordinates for d1qp9a1.
(The format of our PDB-style files is described here.)

Timeline for d1qp9a1: