| Class g: Small proteins [56992] (75 folds) |
| Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily) all-alpha dimetal(zinc)-bound fold |
Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) ![]() duplication: two structural repeats are related by the pseudo dyad |
| Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins) |
| Protein PUT3 [57707] (1 species) |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries) |
| Domain d1ajyb1: 1ajy B:30-66 [45084] Other proteins in same PDB: d1ajya2, d1ajyb2 |
PDB Entry: 1ajy (more details)
SCOP Domain Sequences for d1ajyb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ajyb1 g.38.1.1 (B:30-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae)}
msvaclscrkrhikcpggnpcqkcvtsnaiceyleps
Timeline for d1ajyb1: