PDB entry 1ajy

View 1ajy on RCSB PDB site
Description: structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
Deposited on 1997-05-12, released 1997-09-17
The last revision prior to the SCOP 1.69 freeze date was dated 1997-09-17, with a file datestamp of 1997-09-17.
Experiment type: NMR13
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajyA (A:)
    msvaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndktee
    nnrlkalller
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ajyB (B:)
    msvaclscrkrhikcpggnpcqkcvtsnaiceylepskkivvstkylqqlqkdlndktee
    nnrlkalller