Lineage for d1ajyb1 (1ajy B:30-66)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035544Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
    all-alpha dimetal(zinc)-bound fold
  4. 3035545Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
    duplication: two structural repeats are related by the pseudo dyad
  5. 3035546Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 3035580Protein PUT3 [57707] (1 species)
  7. 3035581Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries)
  8. 3035585Domain d1ajyb1: 1ajy B:30-66 [45084]
    Other proteins in same PDB: d1ajya2, d1ajyb2
    complexed with zn

Details for d1ajyb1

PDB Entry: 1ajy (more details)

PDB Description: structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures
PDB Compounds: (B:) put3

SCOPe Domain Sequences for d1ajyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajyb1 g.38.1.1 (B:30-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
msvaclscrkrhikcpggnpcqkcvtsnaiceyleps

SCOPe Domain Coordinates for d1ajyb1:

Click to download the PDB-style file with coordinates for d1ajyb1.
(The format of our PDB-style files is described here.)

Timeline for d1ajyb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ajyb2