Lineage for d1ajya1 (1ajy A:30-66)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41340Fold g.38: Zn2/Cys6 DNA-binding domain [57700] (1 superfamily)
  4. 41341Superfamily g.38.1: Zn2/Cys6 DNA-binding domain [57701] (1 family) (S)
  5. 41342Family g.38.1.1: Zn2/Cys6 DNA-binding domain [57702] (6 proteins)
  6. 41372Protein PUT3 [57707] (1 species)
  7. 41373Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [57708] (2 PDB entries)
  8. 41376Domain d1ajya1: 1ajy A:30-66 [45083]
    Other proteins in same PDB: d1ajya2, d1ajyb2

Details for d1ajya1

PDB Entry: 1ajy (more details)

PDB Description: structure and mobility of the put3 dimer: a dna pincer, nmr, 13 structures

SCOP Domain Sequences for d1ajya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ajya1 g.38.1.1 (A:30-66) PUT3 {Baker's yeast (Saccharomyces cerevisiae)}
msvaclscrkrhikcpggnpcqkcvtsnaiceyleps

SCOP Domain Coordinates for d1ajya1:

Click to download the PDB-style file with coordinates for d1ajya1.
(The format of our PDB-style files is described here.)

Timeline for d1ajya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ajya2