SCOP 1.55: Domain d1tpn__: 1tpn -

Lineage for d1tpn__ (1tpn -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.27: Fibronectin type I module [57602] (1 superfamily)

4. Superfamily g.27.1: Fibronectin type I module [57603] (1 family)

5. Family g.27.1.1: Fibronectin type I module [57604] (2 proteins)

6. Protein Tissue-type plasminogen activator, t-PA [57607] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57608] (3 PDB entries)

8. Domain d1tpn__: 1tpn - [44956]

Details for d1tpn__

PDB Entry: 1tpn

PDB Description: solution structure of the fibrin binding finger domain of tissue-type plasminogen activator determined by 1h nuclear magnetic resonance

SCOP Domain Sequences for d1tpn__:

Sequence; same for both SEQRES and ATOM records:

>d1tpn__ g.27.1.1 (-) Tissue-type plasminogen activator, t-PA {Human (Homo sapiens)}
syqvicrdektqmiyqqhqswlrpvlrsnrveycwcnsgraqchsvpvks

Timeline for d1tpn__:

• d1tpn__ appears in SCOP 1.57
  
• d1tpn__ appears in the current release, SCOPe 2.08, called d1tpna_