Lineage for d1du3h2 (1du3 H:62-101)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034651Fold g.24: TNF receptor-like [57585] (1 superfamily)
    duplication: consists of three similar disulfide-rich domains
  4. 3034652Superfamily g.24.1: TNF receptor-like [57586] (3 families) (S)
  5. 3034653Family g.24.1.1: TNF receptor-like [57587] (13 proteins)
    Pfam PF00020; TNFR/NGFR cysteine-rich region
  6. Protein Death receptor-5 (dr5) fragment, middle domain [419061] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [419552] (5 PDB entries)
  8. 3034672Domain d1du3h2: 1du3 H:62-101 [44940]
    Other proteins in same PDB: d1du3a1, d1du3a3, d1du3b1, d1du3b3, d1du3c1, d1du3c3, d1du3d_, d1du3e_, d1du3f_, d1du3g1, d1du3g3, d1du3h1, d1du3h3, d1du3i1, d1du3i3, d1du3j_, d1du3k_, d1du3l_
    complexed with zn

Details for d1du3h2

PDB Entry: 1du3 (more details), 2.2 Å

PDB Description: crystal structure of trail-sdr5
PDB Compounds: (H:) death receptor 5

SCOPe Domain Sequences for d1du3h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1du3h2 g.24.1.1 (H:62-101) Death receptor-5 (dr5) fragment, middle domain {Human (Homo sapiens) [TaxId: 9606]}
rctrcdsgevelspctttrntvcqceegtfreedspemcr

SCOPe Domain Coordinates for d1du3h2:

Click to download the PDB-style file with coordinates for d1du3h2.
(The format of our PDB-style files is described here.)

Timeline for d1du3h2: