PDB entry 1du3

View 1du3 on RCSB PDB site
Description: Crystal structure of TRAIL-SDR5
Class: apoptosis
Keywords: TRAIL, DR5, complex, APOPTOSIS
Deposited on 2000-01-14, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.291
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: death receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3a1, d1du3a2, d1du3a3
  • Chain 'B':
    Compound: death receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3b1, d1du3b2, d1du3b3
  • Chain 'C':
    Compound: death receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3c1, d1du3c2, d1du3c3
  • Chain 'D':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3d_
  • Chain 'E':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3e_
  • Chain 'F':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3f_
  • Chain 'G':
    Compound: death receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3g1, d1du3g2, d1du3g3
  • Chain 'H':
    Compound: death receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3h1, d1du3h2, d1du3h3
  • Chain 'I':
    Compound: death receptor 5
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3i1, d1du3i2, d1du3i3
  • Chain 'J':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3j_
  • Chain 'K':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3k_
  • Chain 'L':
    Compound: tnf-related apoptosis inducing ligand
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1du3l_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1du3A (A:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3A (A:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1du3B (B:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3B (B:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhkes
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1du3C (C:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3C (C:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1du3D (D:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3D (D:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1du3E (E:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3E (E:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1du3F (F:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3F (F:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1du3G (G:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3G (G:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpwsdiecvhk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1du3H (H:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3H (H:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1du3I (I:)
    alitqqdlapqqraapqqkrsspseglcppghhisedgrdcisckygqdysthwndllfc
    lrctrcdsgevelspctttrntvcqceegtfreedspemcrkcrtgcprgmvkvgdctpw
    sdiecvhkes
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3I (I:)
    sspseglcppghhisedgrdcisckygqdysthwndllfclrctrcdsgevelspctttr
    ntvcqceegtfreedspemcrkdctpwsdi
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1du3J (J:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3J (J:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1du3K (K:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3K (K:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1du3L (L:)
    vrergpqrvaahitgtrgrsntlsspnsknekalgrkinswessrsghsflsnlhlrnge
    lvihekgfyyiysqtyfrfqeeikentkndkqmvqyiykytsypdpillmksarnscwsk
    daeyglysiyqggifelkendrifvsvtnehlidmdheasffgaflvg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1du3L (L:)
    qrvaahitgtrgrsntalgrkinswessrsghsflsnlhlrngelvihekgfyyiysqty
    frfqeeikentkndkqmvqyiykytsypdpillmksarnscwskdaeyglysiyqggife
    lkendrifvsvtnehlidmdheasffgaflvg