| Class g: Small proteins [56992] (100 folds) |
| Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) ![]() |
| Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
| Protein Death receptor-5 (dr5) fragment, N- and C-terminal domain [419060] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [419551] (5 PDB entries) |
| Domain d1du3g1: 1du3 G:21-61 [44936] Other proteins in same PDB: d1du3a2, d1du3b2, d1du3c2, d1du3d_, d1du3e_, d1du3f_, d1du3g2, d1du3h2, d1du3i2, d1du3j_, d1du3k_, d1du3l_ complexed with zn fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1du3 (more details), 2.2 Å
SCOPe Domain Sequences for d1du3g1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1du3g1 g.24.1.1 (G:21-61) Death receptor-5 (dr5) fragment, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
sspseglcppghhisedgrdcisckygqdysthwndllfcl
Timeline for d1du3g1: