Lineage for d1ncfb1 (1ncf B:14-71)

  1. Root: SCOP 1.61
  2. 202290Class g: Small proteins [56992] (59 folds)
  3. 204347Fold g.24: TNF receptor-like [57585] (1 superfamily)
  4. 204348Superfamily g.24.1: TNF receptor-like [57586] (1 family) (S)
  5. 204349Family g.24.1.1: TNF receptor-like [57587] (3 proteins)
  6. 204386Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 204387Species Human (Homo sapiens) [TaxId:9606] [57589] (4 PDB entries)
  8. 204397Domain d1ncfb1: 1ncf B:14-71 [44909]

Details for d1ncfb1

PDB Entry: 1ncf (more details), 2.25 Å

PDB Description: a new paradigm for tumor necrosis factor signalling

SCOP Domain Sequences for d1ncfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncfb1 g.24.1.1 (B:14-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens)}
vcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcl

SCOP Domain Coordinates for d1ncfb1:

Click to download the PDB-style file with coordinates for d1ncfb1.
(The format of our PDB-style files is described here.)

Timeline for d1ncfb1: