Class g: Small proteins [56992] (100 folds) |
Fold g.24: TNF receptor-like [57585] (1 superfamily) duplication: consists of three similar disulfide-rich domains |
Superfamily g.24.1: TNF receptor-like [57586] (3 families) |
Family g.24.1.1: TNF receptor-like [57587] (13 proteins) Pfam PF00020; TNFR/NGFR cysteine-rich region |
Protein Tumor necrosis factor (TNF) receptor, N-terminal domain [419065] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [419556] (4 PDB entries) |
Domain d1ncfb1: 1ncf B:14-71 [44909] Other proteins in same PDB: d1ncfa2, d1ncfa3, d1ncfa4, d1ncfb2, d1ncfb3 has additional secondary structure elements or disulfide bonds beyond those in the common domain |
PDB Entry: 1ncf (more details), 2.25 Å
SCOPe Domain Sequences for d1ncfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ncfb1 g.24.1.1 (B:14-71) Tumor necrosis factor (TNF) receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} vcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcl
Timeline for d1ncfb1:
View in 3D Domains from other chains: (mouse over for more information) d1ncfa1, d1ncfa2, d1ncfa3, d1ncfa4 |