Lineage for d1ncfb1 (1ncf B:14-71)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 41049Fold g.24: TNF receptor-like [57585] (1 superfamily)
  4. 41050Superfamily g.24.1: TNF receptor-like [57586] (1 family) (S)
  5. 41051Family g.24.1.1: TNF receptor-like [57587] (2 proteins)
  6. 41084Protein Tumor necrosis factor (TNF) receptor [57588] (1 species)
  7. 41085Species Human (Homo sapiens) [TaxId:9606] [57589] (3 PDB entries)
  8. 41095Domain d1ncfb1: 1ncf B:14-71 [44909]

Details for d1ncfb1

PDB Entry: 1ncf (more details), 2.25 Å

PDB Description: a new paradigm for tumor necrosis factor signalling

SCOP Domain Sequences for d1ncfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ncfb1 g.24.1.1 (B:14-71) Tumor necrosis factor (TNF) receptor {Human (Homo sapiens)}
vcpqgkyihpqnnsicctkchkgtylyndcpgpgqdtdcrecesgsftasenhlrhcl

SCOP Domain Coordinates for d1ncfb1:

Click to download the PDB-style file with coordinates for d1ncfb1.
(The format of our PDB-style files is described here.)

Timeline for d1ncfb1: