SCOP 1.55: Domain d1g44c3: 1g44 C:127-183

Lineage for d1g44c3 (1g44 C:127-183)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)

4. Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family)

5. Family g.18.1.1: Complement control module/SCR domain [57536] (4 proteins)

6. Protein Complement control protein [57539] (1 species)

7. Species Vaccinia virus [TaxId:10245] [57540] (6 PDB entries)

8. Domain d1g44c3: 1g44 C:127-183 [44841]

Details for d1g44c3

PDB Entry: 1g44, 2.6 Å

PDB Description: crystal structure of a complement control protein that regulates both pathways of complement activation and binds heparan sulfate proteoglycans

SCOP Domain Sequences for d1g44c3:

Sequence, based on SEQRES records:

>d1g44c3 g.18.1.1 (C:127-183) Complement control protein {Vaccinia virus}
vkcqsppsisngrhngyedfytdgsvvtyscnsgyslignsgvlcsggewsdpptcq

Sequence, based on observed residues (ATOM records):

>d1g44c3 g.18.1.1 (C:127-183) Complement control protein {Vaccinia virus}
vkcqsppsisngrhngyedfytdgsvvtyscnylignsgvlcsggewsdpptcq

Timeline for d1g44c3:

• d1g44c3 appears in SCOP 1.57
  
• d1g44c3 appears in the current release, SCOPe 2.08