Class g: Small proteins [56992] (54 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) |
Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) |
Family g.18.1.1: Complement control module/SCR domain [57536] (4 proteins) |
Protein Factor H, 15th and 16th modules [57537] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [57538] (3 PDB entries) |
Domain d1hfh_2: 1hfh 64-120 [44822] |
PDB Entry: 1hfh (more details)
SCOP Domain Sequences for d1hfh_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hfh_2 g.18.1.1 (64-120) Factor H, 15th and 16th modules {Human (Homo sapiens)} lpcksppeishgvvahmsdsyqygeevtykcfegfgidgpaiakclgekwshppsci
Timeline for d1hfh_2: