Lineage for d1hfh_2 (1hfh 64-120)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40917Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
  4. 40918Superfamily g.18.1: Complement control module/SCR domain [57535] (1 family) (S)
  5. 40919Family g.18.1.1: Complement control module/SCR domain [57536] (4 proteins)
  6. 40978Protein Factor H, 15th and 16th modules [57537] (1 species)
  7. 40979Species Human (Homo sapiens) [TaxId:9606] [57538] (3 PDB entries)
  8. 40983Domain d1hfh_2: 1hfh 64-120 [44822]

Details for d1hfh_2

PDB Entry: 1hfh (more details)

PDB Description: solution structure of a pair of complement modules by nuclear magnetic resonance

SCOP Domain Sequences for d1hfh_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfh_2 g.18.1.1 (64-120) Factor H, 15th and 16th modules {Human (Homo sapiens)}
lpcksppeishgvvahmsdsyqygeevtykcfegfgidgpaiakclgekwshppsci

SCOP Domain Coordinates for d1hfh_2:

Click to download the PDB-style file with coordinates for d1hfh_2.
(The format of our PDB-style files is described here.)

Timeline for d1hfh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hfh_1