Lineage for d1hfha2 (1hfh A:64-120)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3034014Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 3034015Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 3034016Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 3034246Protein Factor H, 15th and 16th modules [57537] (1 species)
  7. 3034247Species Human (Homo sapiens) [TaxId:9606] [57538] (3 PDB entries)
  8. 3034251Domain d1hfha2: 1hfh A:64-120 [44822]
    both modules

Details for d1hfha2

PDB Entry: 1hfh (more details)

PDB Description: solution structure of a pair of complement modules by nuclear magnetic resonance
PDB Compounds: (A:) factor h, 15th and 16th c-module pair

SCOPe Domain Sequences for d1hfha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hfha2 g.18.1.1 (A:64-120) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]}
lpcksppeishgvvahmsdsyqygeevtykcfegfgidgpaiakclgekwshppsci

SCOPe Domain Coordinates for d1hfha2:

Click to download the PDB-style file with coordinates for d1hfha2.
(The format of our PDB-style files is described here.)

Timeline for d1hfha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hfha1