PDB entry 1hfh

View 1hfh on RCSB PDB site
Description: solution structure of a pair of complement modules by nuclear magnetic resonance
Class: glycoprotein
Keywords: glycoprotein
Deposited on 1993-02-23, released 1993-07-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: factor h, 15th and 16th c-module pair
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1hfha1, d1hfha2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1hfhA (A:)
    ekipcsqppqiehgtinssrssqesyahgtklsytceggfriseenettcymgkwssppq
    ceglpcksppeishgvvahmsdsyqygeevtykcfegfgidgpaiakclgekwshppsci