![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.3: Neurotrophin [57520] (5 proteins) automatically mapped to Pfam PF00243 |
![]() | Protein beta-Nerve growth factor [57525] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57526] (4 PDB entries) |
![]() | Domain d1btgb_: 1btg B: [44803] complexed with zn |
PDB Entry: 1btg (more details), 2.5 Å
SCOPe Domain Sequences for d1btgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btgb_ g.17.1.3 (B:) beta-Nerve growth factor {Mouse (Mus musculus) [TaxId: 10090]} gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
Timeline for d1btgb_: