PDB entry 1btg

View 1btg on RCSB PDB site
Description: crystal structure of beta nerve growth factor at 2.5 a resolution in c2 space group with zn ions bound
Class: growth factor
Keywords: nerve, growth factor
Deposited on 1995-08-29, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.179
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btga_
  • Chain 'B':
    Compound: beta nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btgb_
  • Chain 'C':
    Compound: beta nerve growth factor
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1btgc_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1btgA (A:)
    mgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgc
    rgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btgA (A:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1btgB (B:)
    mgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgc
    rgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btgB (B:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1btgC (C:)
    mgefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgc
    rgidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1btgC (C:)
    gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
    gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr