Lineage for d1btgb_ (1btg B:)
- Root: SCOP 1.55
Class g: Small proteins [56992] (54 folds) 
Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) Superfamily g.17.1: Cystine-knot cytokines [57501] (5 families) 
Family g.17.1.3: Neurotrophin [57520] (3 proteins) 
Protein beta-Nerve growth factor [57525] (2 species) 
Species Mouse (Mus musculus) [TaxId:10090] [57526] (3 PDB entries) 
Domain d1btgb_: 1btg B: [44803]
Details for d1btgb_
PDB Entry: 1btg (more details), 2.5 Å
PDB Description: crystal structure of beta nerve growth factor at 2.5 a resolution in c2 space group with zn ions bound
SCOP Domain Sequences for d1btgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1btgb_ g.17.1.3 (B:) beta-Nerve growth factor {Mouse (Mus musculus)}
gefsvcdsvsvwvgdkttatdikgkevtvlaevninnsvfrqyffetkcrasnpvesgcr
gidskhwnsycttthtfvkalttdekqaawrfiridtacvcvlsrkatr
SCOP Domain Coordinates for d1btgb_:
Click to download the PDB-style file with coordinates for d1btgb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1btgb_:
- d1btgb_ appears in SCOP 1.57
- d1btgb_ appears in the current release, SCOPe 2.08
View in 3D
