SCOP 1.63: Domain d1tbrr1: 1tbr R:1-51

Lineage for d1tbrr1 (1tbr R:1-51)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
   disulphide-rich small alpha+beta fold

4. Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families)
   two families share the same beta-sheet topology but differ in the active-site loop location

5. Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins)

6. Protein Blood-sucking insect-derived tryptase inhibitor [57476] (1 species)
   duplication: contains two domains of this fold

7. Species Bug (Rhodnius prolixus), rhodniin [TaxId:13249] [57477] (2 PDB entries)

8. Domain d1tbrr1: 1tbr R:1-51 [44707]
   Other proteins in same PDB: d1tbr.1, d1tbr.2

Details for d1tbrr1

PDB Entry: 1tbr, 2.6 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbrr1:

Sequence; same for both SEQRES and ATOM records:

>d1tbrr1 g.15.1.1 (R:1-51) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin}
eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepd

Timeline for d1tbrr1:

• d1tbrr1 first appeared (with stable ids) in SCOP 1.55
  
• d1tbrr1 appears in SCOP 1.61
  
• d1tbrr1 appears in SCOP 1.65
  
• d1tbrr1 appears in the current release, SCOPe 2.08