Lineage for d1tbrr1 (1tbr R:1-51)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 3038436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 3038437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 3038441Protein Blood-sucking insect-derived tryptase inhibitor [57476] (2 species)
    duplication: contains two domains of this fold
  7. 3038442Species Rhodnius prolixus, rhodniin [TaxId:13249] [57477] (2 PDB entries)
  8. 3038443Domain d1tbrr1: 1tbr R:1-51 [44707]
    Other proteins in same PDB: d1tbr.1, d1tbr.2

Details for d1tbrr1

PDB Entry: 1tbr (more details), 2.6 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin
PDB Compounds: (R:) rhodniin

SCOPe Domain Sequences for d1tbrr1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tbrr1 g.68.1.1 (R:1-51) Blood-sucking insect-derived tryptase inhibitor {Rhodnius prolixus, rhodniin [TaxId: 13249]}
eggepcacphalhrvcgsdgetysnpctlncakfngkpelvkvhdgpcepd

SCOPe Domain Coordinates for d1tbrr1:

Click to download the PDB-style file with coordinates for d1tbrr1.
(The format of our PDB-style files is described here.)

Timeline for d1tbrr1: