Lineage for d1tbr.1 (1tbr L:,H:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 230291Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 230292Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 230387Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins)
  6. 230721Protein Thrombin [50531] (2 species)
  7. 230722Species Cow (Bos taurus) [TaxId:9913] [50533] (19 PDB entries)
  8. 230743Domain d1tbr.1: 1tbr L:,H: [26217]
    Other proteins in same PDB: d1tbrr1, d1tbrr2, d1tbrs1, d1tbrs2

Details for d1tbr.1

PDB Entry: 1tbr (more details), 2.6 Å

PDB Description: crystal structure of insect derived double domain kazal inhibitor rhodniin in complex with thrombin

SCOP Domain Sequences for d1tbr.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1tbr.1 b.47.1.2 (L:,H:) Thrombin {Cow (Bos taurus)}
tsedhfqpffnektfgageadcglrplfekkqvqdqtekelfesyiegrXivegqdaevg
lspwqvmlfrkspqellcgaslisdrwvltaahcllyppwdknftvddllvrigkhsrtr
yerkvekismldkiyihprynwkenldrdiallklkrpielsdyihpvclpdkqtaakll
hagfkgrvtgwgnrretwttsvaevqpsvlqvvnlplverpvckastriritdnmfcagy
kpgegkrgdacegdsggpfvmkspynnrwyqmgivswgegcdrdgkygfythvfrlkkwi
qkvidrlgs

SCOP Domain Coordinates for d1tbr.1:

Click to download the PDB-style file with coordinates for d1tbr.1.
(The format of our PDB-style files is described here.)

Timeline for d1tbr.1: