Lineage for d1tgsi_ (1tgs I:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2643121Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2643122Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2643123Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2643210Protein Secretory trypsin inhibitor [57473] (2 species)
  7. 2643215Species Pig (Sus scrofa) [TaxId:9823] [57475] (1 PDB entry)
  8. 2643216Domain d1tgsi_: 1tgs I: [44706]
    Other proteins in same PDB: d1tgsz_
    complexed with ca, so4

Details for d1tgsi_

PDB Entry: 1tgs (more details), 1.8 Å

PDB Description: three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation
PDB Compounds: (I:) pancreatic secretory trypsin inhibitor (kazal type)

SCOPe Domain Sequences for d1tgsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]}
tspqreatctsevsgcpkiynpvcgtdgitysnecvlcsenkkrqtpvliqksgpc

SCOPe Domain Coordinates for d1tgsi_:

Click to download the PDB-style file with coordinates for d1tgsi_.
(The format of our PDB-style files is described here.)

Timeline for d1tgsi_: