Class g: Small proteins [56992] (98 folds) |
Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily) |
Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) conserved core consists of a helix and a loop crosslinked with two disulfides |
Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins) |
Protein Secretory trypsin inhibitor [57473] (2 species) |
Species Pig (Sus scrofa) [TaxId:9823] [57475] (1 PDB entry) |
Domain d1tgsi_: 1tgs I: [44706] Other proteins in same PDB: d1tgsz_ complexed with ca, so4 |
PDB Entry: 1tgs (more details), 1.8 Å
SCOPe Domain Sequences for d1tgsi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} tspqreatctsevsgcpkiynpvcgtdgitysnecvlcsenkkrqtpvliqksgpc
Timeline for d1tgsi_: