SCOPe 2.06: Domain d1tgsi_: 1tgs I:

Lineage for d1tgsi_ (1tgs I:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)

4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families)
   conserved core consists of a helix and a loop crosslinked with two disulfides

5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)

6. Protein Secretory trypsin inhibitor [57473] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [57475] (1 PDB entry)

8. Domain d1tgsi_: 1tgs I: [44706]
   Other proteins in same PDB: d1tgsz_
   complexed with ca, so4

Details for d1tgsi_

PDB Entry: 1tgs, 1.8 Å

PDB Description: three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation

PDB Compounds: (I:) pancreatic secretory trypsin inhibitor (kazal type)

SCOPe Domain Sequences for d1tgsi_:

Sequence; same for both SEQRES and ATOM records:

>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]}
tspqreatctsevsgcpkiynpvcgtdgitysnecvlcsenkkrqtpvliqksgpc

Timeline for d1tgsi_:

• d1tgsi_ first appeared (with stable ids) in SCOP 1.55
  
• d1tgsi_ appears in SCOPe 2.05
  
• d1tgsi_ appears in SCOPe 2.07
  
• d1tgsi_ appears in the current release, SCOPe 2.08