Lineage for d1tgsi_ (1tgs I:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40708Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 40709Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 40710Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 40763Protein Secretory trypsin inhibitor [57473] (2 species)
  7. 40768Species Pig (Sus scrofa) [TaxId:9823] [57475] (1 PDB entry)
  8. 40769Domain d1tgsi_: 1tgs I: [44706]
    Other proteins in same PDB: d1tgsz_

Details for d1tgsi_

PDB Entry: 1tgs (more details), 1.8 Å

PDB Description: three-dimensional structure of the complex between pancreatic secretory inhibitor (kazal type) and trypsinogen at 1.8 angstroms resolution. structure solution, crystallographic refinement and preliminary structural interpretation

SCOP Domain Sequences for d1tgsi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tgsi_ g.15.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa)}
tspqreatctsevsgcpkiynpvcgtdgitysnecvlcsenkkrqtpvliqksgpc

SCOP Domain Coordinates for d1tgsi_:

Click to download the PDB-style file with coordinates for d1tgsi_.
(The format of our PDB-style files is described here.)

Timeline for d1tgsi_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1tgsz_