SCOP 1.63: Domain d1cgji_: 1cgj I:

Lineage for d1cgji_ (1cgj I:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
   disulphide-rich small alpha+beta fold

4. Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families)
   two families share the same beta-sheet topology but differ in the active-site loop location

5. Family g.15.1.1: Animal Kazal-type inhibitors [57468] (9 proteins)

6. Protein Secretory trypsin inhibitor [57473] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries)

8. Domain d1cgji_: 1cgj I: [44705]
   Other proteins in same PDB: d1cgje_

Details for d1cgji_

PDB Entry: 1cgj, 2.3 Å

PDB Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)

SCOP Domain Sequences for d1cgji_:

Sequence; same for both SEQRES and ATOM records:

>d1cgji_ g.15.1.1 (I:) Secretory trypsin inhibitor {Human (Homo sapiens)}
dslgreakcynelngctleyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc

Timeline for d1cgji_:

• d1cgji_ first appeared (with stable ids) in SCOP 1.55
  
• d1cgji_ appears in SCOP 1.61
  
• d1cgji_ appears in SCOP 1.65
  
• d1cgji_ appears in the current release, SCOPe 2.08