Lineage for d1cgji_ (1cgj I:)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. Protein Secretory trypsin inhibitor [57473] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries)
  8. Domain d1cgji_: 1cgj I: [44705]
    Other proteins in same PDB: d1cgje_

Details for d1cgji_

PDB Entry: 1cgj (more details), 2.3 Å

PDB Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)
PDB Compounds: (I:) pancreatic secretory trypsin inhibitor (kazal type) variant 4

SCOPe Domain Sequences for d1cgji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgji_ g.68.1.1 (I:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]}
dslgreakcynelngctleyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc

SCOPe Domain Coordinates for d1cgji_ are not available.

Timeline for d1cgji_:

Domains from other chains:
(mouse over for more information)
d1cgje_