Lineage for d1cgji_ (1cgj I:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589435Fold g.68: Kazal-type serine protease inhibitors [100894] (1 superfamily)
  4. 2589436Superfamily g.68.1: Kazal-type serine protease inhibitors [100895] (3 families) (S)
    conserved core consists of a helix and a loop crosslinked with two disulfides
  5. 2589437Family g.68.1.1: Ovomucoid domain III-like [57468] (11 proteins)
  6. 2589524Protein Secretory trypsin inhibitor [57473] (2 species)
  7. 2589525Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries)
  8. 2589527Domain d1cgji_: 1cgj I: [44705]
    Other proteins in same PDB: d1cgje_

Details for d1cgji_

PDB Entry: 1cgj (more details), 2.3 Å

PDB Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)
PDB Compounds: (I:) pancreatic secretory trypsin inhibitor (kazal type) variant 4

SCOPe Domain Sequences for d1cgji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgji_ g.68.1.1 (I:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]}
dslgreakcynelngctleyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc

SCOPe Domain Coordinates for d1cgji_:

Click to download the PDB-style file with coordinates for d1cgji_.
(The format of our PDB-style files is described here.)

Timeline for d1cgji_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cgje_