Lineage for d1cgji_ (1cgj I:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40708Fold g.15: Ovomucoid/PCI-1 like inhibitors [57466] (1 superfamily)
  4. 40709Superfamily g.15.1: Ovomucoid/PCI-1 like inhibitors [57467] (2 families) (S)
  5. 40710Family g.15.1.1: Animal Kazal-type inhibitors [57468] (7 proteins)
  6. 40763Protein Secretory trypsin inhibitor [57473] (2 species)
  7. 40764Species Human (Homo sapiens) [TaxId:9606] [57474] (3 PDB entries)
  8. 40767Domain d1cgji_: 1cgj I: [44705]
    Other proteins in same PDB: d1cgje_

Details for d1cgji_

PDB Entry: 1cgj (more details), 2.3 Å

PDB Description: three-dimensional structure of the complexes between bovine chymotrypsinogen*a and two recombinant variants of human pancreatic secretory trypsin inhibitor (kazal-type)

SCOP Domain Sequences for d1cgji_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cgji_ g.15.1.1 (I:) Secretory trypsin inhibitor {Human (Homo sapiens)}
dslgreakcynelngctleyrpvcgtdgdtypnecvlcfenrkrqtsiliqksgpc

SCOP Domain Coordinates for d1cgji_:

Click to download the PDB-style file with coordinates for d1cgji_.
(The format of our PDB-style files is described here.)

Timeline for d1cgji_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cgje_