SCOPe 2.06: Domain d1cxwa_: 1cxw A:

Lineage for d1cxwa_ (1cxw A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.14: Kringle-like [57439] (1 superfamily)
   disulfide-rich fold; nearly all-beta

4. Superfamily g.14.1: Kringle-like [57440] (3 families)

5. Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
   shorter two-disulfide version of a kringle module

6. Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
   duplication: tandem repeat of three modules inserted in the catalytic domain

7. Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)

8. Domain d1cxwa_: 1cxw A: [44677]
   second module only

Details for d1cxwa_

PDB Entry: 1cxw

PDB Description: the second type ii module from human matrix metalloproteinase 2

PDB Compounds: (A:) human matrix metalloproteinase 2

SCOPe Domain Sequences for d1cxwa_:

Sequence; same for both SEQRES and ATOM records:

>d1cxwa_ g.14.1.2 (A:) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]}
talftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpeta

Timeline for d1cxwa_:

• d1cxwa_ first appeared (with stable ids) in SCOP 1.55
  
• d1cxwa_ appears in SCOPe 2.05
  
• d1cxwa_ appears in SCOPe 2.07
  
• d1cxwa_ appears in the current release, SCOPe 2.08, called d1cxwa1