Lineage for d1cxwa_ (1cxw A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638013Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 2638014Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 2638179Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. 2638188Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
    duplication: tandem repeat of three modules inserted in the catalytic domain
  7. 2638189Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)
  8. 2638212Domain d1cxwa_: 1cxw A: [44677]
    second module only

Details for d1cxwa_

PDB Entry: 1cxw (more details)

PDB Description: the second type ii module from human matrix metalloproteinase 2
PDB Compounds: (A:) human matrix metalloproteinase 2

SCOPe Domain Sequences for d1cxwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxwa_ g.14.1.2 (A:) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]}
talftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpeta

SCOPe Domain Coordinates for d1cxwa_:

Click to download the PDB-style file with coordinates for d1cxwa_.
(The format of our PDB-style files is described here.)

Timeline for d1cxwa_: