Lineage for d1cxwa1 (1cxw A:2-60)

  1. Root: SCOPe 2.08
  2. Class g: Small proteins [56992] (100 folds)
  3. Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. Family g.14.1.2: Fibronectin type II module [57459] (4 proteins)
    shorter two-disulfide version of a kringle module
  6. Protein Gelatinase A (MMP-2) type II modules [57464] (1 species)
    duplication: tandem repeat of three modules inserted in the catalytic domain
  7. Species Human (Homo sapiens) [TaxId:9606] [57465] (6 PDB entries)
  8. Domain d1cxwa1: 1cxw A:2-60 [44677]
    Other proteins in same PDB: d1cxwa2
    second module only

Details for d1cxwa1

PDB Entry: 1cxw (more details)

PDB Description: the second type ii module from human matrix metalloproteinase 2
PDB Compounds: (A:) human matrix metalloproteinase 2

SCOPe Domain Sequences for d1cxwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cxwa1 g.14.1.2 (A:2-60) Gelatinase A (MMP-2) type II modules {Human (Homo sapiens) [TaxId: 9606]}
alftmggnaegqpckfpfrfqgtsydscttegrtdgyrwcgttedydrdkkygfcpeta

SCOPe Domain Coordinates for d1cxwa1 are not available.

Timeline for d1cxwa1:

Domains from same chain:
(mouse over for more information)
d1cxwa2