Lineage for d1e88a1 (1e88 A:42-101)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40632Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 40633Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 40690Family g.14.1.2: Fibronectin type II module [57459] (3 proteins)
  6. 40691Protein Fibronectin [57462] (1 species)
  7. 40692Species Human (Homo sapiens) [TaxId:9606] [57463] (4 PDB entries)
  8. 40693Domain d1e88a1: 1e88 A:42-101 [44669]
    Other proteins in same PDB: d1e88a3

Details for d1e88a1

PDB Entry: 1e88 (more details)

PDB Description: solution structure of 6f11f22f2, a compact three-module fragment of the gelatin-binding domain of human fibronectin

SCOP Domain Sequences for d1e88a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e88a1 g.14.1.2 (A:42-101) Fibronectin {Human (Homo sapiens)}
avtqtyggnsngepcvlpftyngrtfyscttegrqdghlwcsttsnyeqdqkysfctdht

SCOP Domain Coordinates for d1e88a1:

Click to download the PDB-style file with coordinates for d1e88a1.
(The format of our PDB-style files is described here.)

Timeline for d1e88a1: