![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.14: Kringle-like [57439] (1 superfamily) disulfide-rich fold; nearly all-beta |
![]() | Superfamily g.14.1: Kringle-like [57440] (3 families) ![]() |
![]() | Family g.14.1.1: Kringle modules [57441] (7 proteins) |
![]() | Protein Prothrombin [57448] (1 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries) |
![]() | Domain d2spta1: 2spt A:66-145 [44653] Other proteins in same PDB: d2spta2 complexed with nag, sr |
PDB Entry: 2spt (more details), 2.5 Å
SCOPe Domain Sequences for d2spta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2spta1 g.14.1.1 (A:66-145) Prothrombin {Cow (Bos taurus) [TaxId: 9913]} caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp wcyttsptlrreecsvpvcg
Timeline for d2spta1: