Lineage for d2spta1 (2spt A:66-145)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033377Protein Prothrombin [57448] (1 species)
  7. 3033378Species Cow (Bos taurus) [TaxId:9913] [57449] (5 PDB entries)
  8. 3033382Domain d2spta1: 2spt A:66-145 [44653]
    Other proteins in same PDB: d2spta2
    complexed with nag, sr

Details for d2spta1

PDB Entry: 2spt (more details), 2.5 Å

PDB Description: differences in the metal ion structure between sr-and ca-prothrombin fragment 1
PDB Compounds: (A:) Prothrombin

SCOPe Domain Sequences for d2spta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2spta1 g.14.1.1 (A:66-145) Prothrombin {Cow (Bos taurus) [TaxId: 9913]}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcg

SCOPe Domain Coordinates for d2spta1:

Click to download the PDB-style file with coordinates for d2spta1.
(The format of our PDB-style files is described here.)

Timeline for d2spta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2spta2