Lineage for d2spt_1 (2spt 66-145)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40632Fold g.14: Kringle-like [57439] (1 superfamily)
  4. 40633Superfamily g.14.1: Kringle-like [57440] (2 families) (S)
  5. 40634Family g.14.1.1: Kringle modules [57441] (8 proteins)
  6. 40681Protein Prothrombin fragment 1 and 2 [57448] (1 species)
  7. 40682Species Cow (Bos taurus) [TaxId:9913] [57449] (3 PDB entries)
  8. 40685Domain d2spt_1: 2spt 66-145 [44653]
    Other proteins in same PDB: d2spt_2

Details for d2spt_1

PDB Entry: 2spt (more details), 2.5 Å

PDB Description: differences in the metal ion structure between sr-and ca-prothrombin fragment 1

SCOP Domain Sequences for d2spt_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2spt_1 g.14.1.1 (66-145) Prothrombin fragment 1 and 2 {Cow (Bos taurus)}
caegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdgsitgp
wcyttsptlrreecsvpvcg

SCOP Domain Coordinates for d2spt_1:

Click to download the PDB-style file with coordinates for d2spt_1.
(The format of our PDB-style files is described here.)

Timeline for d2spt_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2spt_2