PDB entry 2spt

View 2spt on RCSB PDB site
Description: differences in the metal ion structure between sr-and ca-prothrombin fragment 1
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1994-02-01, released 1994-05-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00735 (0-144)
      • conflict (6-7)
      • conflict (14)
      • conflict (16)
      • conflict (19-20)
      • conflict (25-26)
      • conflict (29)
      • conflict (32)
    Domains in SCOPe 2.08: d2spta1, d2spta2
  • Heterogens: NAG, SR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2sptA (A:)
    ankgfleevrkgnlerecleepcsreeafealeslsatdafwakytacesarnpreklne
    clegncaegvgmnyrgnvsvtrsgiecqlwrsryphkpeinstthpgadlrenfcrnpdg
    sitgpwcyttsptlrreecsvpvcg