Lineage for d1ca0i_ (1ca0 I:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032521Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)
  6. 3032525Protein Alzheimer's amyloid B-protein precursor, APPI [57370] (1 species)
  7. 3032526Species Human (Homo sapiens) [TaxId:9606] [57371] (4 PDB entries)
  8. 3032530Domain d1ca0i_: 1ca0 I: [44547]
    Other proteins in same PDB: d1ca0.1, d1ca0.2

Details for d1ca0i_

PDB Entry: 1ca0 (more details), 2.1 Å

PDB Description: bovine chymotrypsin complexed to appi
PDB Compounds: (I:) protease inhibitor domain of alzheimer's amyloid beta-protein precursor

SCOPe Domain Sequences for d1ca0i_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ca0i_ g.8.1.1 (I:) Alzheimer's amyloid B-protein precursor, APPI {Human (Homo sapiens) [TaxId: 9606]}
evcseqaetgpcramisrwyfdvtegkcapffyggcggnrnnfdteeycmavcg

SCOPe Domain Coordinates for d1ca0i_:

Click to download the PDB-style file with coordinates for d1ca0i_.
(The format of our PDB-style files is described here.)

Timeline for d1ca0i_: