SCOPe 2.08: Domain d1ca0.2: 1ca0 F:,G:,H:

Lineage for d1ca0.2 (1ca0 F:,G:,H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein (alpha,gamma)-chymotrypsin(ogen) [50522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50523] (66 PDB entries)
   Uniprot P00766

8. Domain d1ca0.2: 1ca0 F:,G:,H: [26054]
   Other proteins in same PDB: d1ca0d_, d1ca0i_

Details for d1ca0.2

PDB Entry: 1ca0, 2.1 Å

PDB Description: bovine chymotrypsin complexed to appi

PDB Compounds: (F:) bovine chymotrypsin, (G:) bovine chymotrypsin, (H:) bovine chymotrypsin

SCOPe Domain Sequences for d1ca0.2:

Sequence; same for both SEQRES and ATOM records:

>g1ca0.2 b.47.1.2 (F:,G:,H:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
cgvpaiqpvlsXivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvtts
dvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavcl
psasddfaagttcvttgwgltryXantpdrlqqaslpllsntnckkywgtkikdamicag
asgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaa
n

Timeline for d1ca0.2:

• d1ca0.2 first appeared (with stable ids) in SCOP 1.55
  
• d1ca0.2 appears in SCOPe 2.07