SCOPe 2.02: Domain d1es7d_: 1es7 D:

Lineage for d1es7d_ (1es7 D:)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (5 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)

8. Domain d1es7d_: 1es7 D: [44466]
   Other proteins in same PDB: d1es7a_, d1es7c_

Details for d1es7d_

PDB Entry: 1es7, 2.9 Å

PDB Description: complex between bmp-2 and two bmp receptor ia ectodomains

PDB Compounds: (D:) bone morphogenetic protein receptor ia

SCOPe Domain Sequences for d1es7d_:

Sequence, based on SEQRES records:

>d1es7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
kaqlrrtieccrtnlcnqylqptlppvvi

Sequence, based on observed residues (ATOM records):

>d1es7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieedettlasgcmkyegsdfqckdspkaq
lrrtieccrtnlcnqylqptlppvvi

Timeline for d1es7d_:

• d1es7d_ first appeared (with stable ids) in SCOP 1.55
  
• d1es7d_ appears in SCOPe 2.01
  
• d1es7d_ appears in SCOPe 2.03
  
• d1es7d_ appears in the current release, SCOPe 2.08