Lineage for d1es7d_ (1es7 D:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1062938Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1062939Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1063138Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins)
  6. 1063139Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 1063140Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)
  8. 1063149Domain d1es7d_: 1es7 D: [44466]
    Other proteins in same PDB: d1es7a_, d1es7c_

Details for d1es7d_

PDB Entry: 1es7 (more details), 2.9 Å

PDB Description: complex between bmp-2 and two bmp receptor ia ectodomains
PDB Compounds: (D:) bone morphogenetic protein receptor ia

SCOPe Domain Sequences for d1es7d_:

Sequence, based on SEQRES records: (download)

>d1es7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
kaqlrrtieccrtnlcnqylqptlppvvi

Sequence, based on observed residues (ATOM records): (download)

>d1es7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
tlpflkcycsghcpddainntcitnghcfaiieedettlasgcmkyegsdfqckdspkaq
lrrtieccrtnlcnqylqptlppvvi

SCOPe Domain Coordinates for d1es7d_:

Click to download the PDB-style file with coordinates for d1es7d_.
(The format of our PDB-style files is described here.)

Timeline for d1es7d_: