Lineage for d1es7d_ (1es7 D:)

  1. Root: SCOP 1.55
  2. 39385Class g: Small proteins [56992] (54 folds)
  3. 40254Fold g.7: Snake toxin-like [57301] (1 superfamily)
  4. 40255Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 40376Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (3 proteins)
  6. 40377Protein BMP receptor Ia ectodomain [57359] (1 species)
  7. 40378Species Human (Homo sapiens) [TaxId:9606] [57360] (1 PDB entry)
  8. 40380Domain d1es7d_: 1es7 D: [44466]
    Other proteins in same PDB: d1es7a_, d1es7c_

Details for d1es7d_

PDB Entry: 1es7 (more details), 2.9 Å

PDB Description: complex between bmp-2 and two bmp receptor ia ectodomains

SCOP Domain Sequences for d1es7d_:

Sequence, based on SEQRES records: (download)

>d1es7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens)}
tlpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdsp
kaqlrrtieccrtnlcnqylqptlppvvi

Sequence, based on observed residues (ATOM records): (download)

>d1es7d_ g.7.1.3 (D:) BMP receptor Ia ectodomain {Human (Homo sapiens)}
tlpflkcycsghcpddainntcitnghcfaiieedettlasgcmkyegsdfqckdspkaq
lrrtieccrtnlcnqylqptlppvvi

SCOP Domain Coordinates for d1es7d_:

Click to download the PDB-style file with coordinates for d1es7d_.
(The format of our PDB-style files is described here.)

Timeline for d1es7d_: