SCOP 1.63: Domain d1bteb_: 1bte B:

Lineage for d1bteb_ (1bte B:)

1. Root: SCOP 1.63

2. Class g: Small proteins [56992] (61 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulphide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)

6. Protein Type II activin receptor [57357] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57358] (1 PDB entry)

8. Domain d1bteb_: 1bte B: [44464]
   complexed with nag

Details for d1bteb_

PDB Entry: 1bte, 1.5 Å

PDB Description: crystal structure of the extracellular domain of the type ii activin receptor

SCOP Domain Sequences for d1bteb_:

Sequence; same for both SEQRES and ATOM records:

>d1bteb_ g.7.1.3 (B:) Type II activin receptor {Mouse (Mus musculus)}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfpe

Timeline for d1bteb_:

• d1bteb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bteb_ appears in SCOP 1.61
  
• d1bteb_ appears in SCOP 1.65
  
• d1bteb_ appears in the current release, SCOPe 2.08